PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA32G00382
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 329aa    MW: 36515.7 Da    PI: 4.7521
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA32G00382genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.3e-17246305261
                 XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                 ++ +r+rr++kNRe+A rsR+RK+a++ eLe+ +++Le+eN++L  e+ee +ke ++  +
  AA32G00382 246 AAAQRQRRMIKNRESAARSRERKQAYQVELETLAAKLEKENEMLSREIEERRKERYQKLM 305
                 5789**********************************************9999887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-13243300No hitNo description
SMARTSM003382.2E-12245309IPR004827Basic-leucine zipper domain
PfamPF001705.1E-16246306IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.415247299IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-10249301No hitNo description
CDDcd147071.33E-19249289No hitNo description
PROSITE patternPS000360252267IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MASFKVMRSS SNSRNSDLSR RISTTSSSSI RPQQFIREDF NADQTTINGG YGGKNDEYNI  60
PTGMTVEGII HDAFTSDPPV AESTLLDASM NLMDASTPME IAVTDADRNT DPANGGDGGG  120
EATTETRVKS VDEVWREIVT GESKGMKEET QEDIMTLEDF LAKAAVEDAA AGRGGDSDDI  180
EVKIPSERLS CGGGVYAYDQ QTHNPFQMID KVEGSIVAFG NGLDVYDGGG TRGKRARVMV  240
EPLDKAAAQR QRRMIKNRES AARSRERKQA YQVELETLAA KLEKENEMLS REIEERRKER  300
YQKLMEFVIP VVEKAQAPRL LRRIRSLEW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199221.11e-132basic leucine zipper transcription factor
SwissprotP427777e-78GBF4_ARATH; G-box-binding factor 4
TrEMBLQ8LCQ71e-133Q8LCQ7_ARATH; Putative uncharacterized protein
STRINGAT5G44080.11e-132(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.11e-113bZIP family protein